DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and LRRC66

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:XP_047271600.1 Gene:LRRC66 / 339977 HGNCID:34299 Length:932 Species:Homo sapiens


Alignment Length:288 Identity:76/288 - (26%)
Similarity:115/288 - (39%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 ITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVINAD--------------TFAGLESTLM 478
            |..|.||.|:|.::....|....:|..|:||.|::..::.|              :|......|.
Human   139 IKHLDLSNNLISKITLSPFAYLHALEVLNLSNNAIHSLSLDLLSPKSSWVKRHRSSFRNRFPLLK 203

  Fly   479 ALKLSQNRLTGLGGAPWVLPELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFK 543
            .|.|.:|:|:......|.|..|:|||||.|.:.::..:.|.....:::|.|..|.:..:....||
Human   204 VLILQRNKLSDTPKGLWKLKSLQSLDLSFNGILQIGWSDFHNCLQLENLCLKSNKIFKIPPQAFK 268

  Fly   544 PLDRLQVIDLSGCNIRQISGDLLAGLQDLKHIY--LNDNQ---------LQELQDGSFVNLWNIS 597
            .|.:|||||||...:..|...::..| :..|:.  |.||.         .|.....|:...||: 
Human   269 DLKKLQVIDLSNNALITILPMMIIAL-EFPHLVVDLADNNWQCDDSVAVFQNFISESWRKKWNV- 331

  Fly   598 SIDLSNNRIGSIRSGA------FVNVMKLQKLDLHG-NQLSAFKGEYFNTG--TGIEELDISDNQ 653
               :.|..|||..:..      .....:|..:.||. ..|...|.|....|  |||..|......
Human   332 ---ICNRSIGSEEANGGTPQSRISRETRLPPIHLHRMKSLIRSKAERPQGGRHTGISTLGKKAKA 393

  Fly   654 LSYLFPSSFRIHPR----LREIRAANNK 677
            .|.|.....|: ||    .|:::||..|
Human   394 GSGLRKKQRRL-PRSVRSTRDVQAAGKK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 76/288 (26%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380 7/22 (32%)
leucine-rich repeat 452..473 CDD:275380 7/34 (21%)
leucine-rich repeat 477..497 CDD:275378 6/19 (32%)
leucine-rich repeat 500..523 CDD:275380 8/22 (36%)
leucine-rich repeat 524..547 CDD:275380 6/22 (27%)
leucine-rich repeat 548..571 CDD:275380 9/22 (41%)
leucine-rich repeat 572..595 CDD:275380 6/33 (18%)
leucine-rich repeat 596..619 CDD:275380 4/28 (14%)
leucine-rich repeat 620..643 CDD:275380 7/25 (28%)
leucine-rich repeat 644..667 CDD:275380 5/22 (23%)
leucine-rich repeat 668..691 CDD:275380 4/10 (40%)
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
LRRC66XP_047271600.1 leucine-rich repeat 116..138 CDD:275380
LRR <138..>307 CDD:443914 47/168 (28%)
leucine-rich repeat 140..162 CDD:275380 6/21 (29%)
leucine-rich repeat 163..201 CDD:275380 7/37 (19%)
leucine-rich repeat 202..224 CDD:275380 7/21 (33%)
leucine-rich repeat 225..248 CDD:275380 8/22 (36%)
leucine-rich repeat 249..272 CDD:275380 6/22 (27%)
leucine-rich repeat 273..294 CDD:275380 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.