DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7896 and Islr2

DIOPT Version :9

Sequence 1:	NP_651754.1	Gene:	CG7896 / 43552	FlyBaseID:	FBgn0039728	Length:	1392	Species:	Drosophila melanogaster
Sequence 2:	NP_001155007.1	Gene:	Islr2 / 320563	MGIID:	2444277	Length:	789	Species:	Mus musculus

Alignment Length:	207	Identity:	61/207 - (29%)
Similarity:	97/207 - (46%)	Gaps:	29/207 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 SLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPG 393
            ::.:|.:|.|.||.:..|.|..:..:..|.|:.:.:||:|..||..|..|:.|.:..|.|...|.
Mouse    96 NVTTLSLSANKITVLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNLISNFPW 160

  Fly   394 SALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLS 458
            |.|..|..|..|::::||:.:|..:.||:|.  |:.:|.::.|.:|.|.||:|...|:|..|.|.
Mouse   161 SDLRNLSALQLLKMNHNRLGSLPRDALGALP--DLRSLRINNNRLRTLEPGTFDALSALSHLQLY 223

  Fly   459 GN----SLAVINADTFAGLESTLMALK---------------LSQNRLTGLGGAPWVLPELRSLD 504
            .|    |..::....:|.  ||.::|.               :..:||..|..||   |.:|
Mouse   224 HNPFHCSCGLVWLQAWAA--STRVSLPEPDSIACASPPELQGVPVHRLPALPCAP---PSVR--- 280

  Fly   505 LSGNTLTELPST 516
            ||.....|.|.|
Mouse   281 LSAEPPPEAPGT 292

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7896	NP_651754.1	LRR_8	109..172	CDD:290566
		leucine-rich repeat	109..132	CDD:275380
		LRR_RI	<132..338	CDD:238064	2/8 (25%)
		leucine-rich repeat	133..161	CDD:275380
		LRR_8	160..220	CDD:290566
		leucine-rich repeat	162..185	CDD:275380
		leucine-rich repeat	186..209	CDD:275380
		leucine-rich repeat	210..233	CDD:275380
		LRR_8	232..290	CDD:290566
		leucine-rich repeat	234..257	CDD:275380
		leucine-rich repeat	258..281	CDD:275380
		LRR_RI	273..535	CDD:238064	61/207 (29%)
		LRR_8	281..338	CDD:290566	2/8 (25%)
		leucine-rich repeat	282..329	CDD:275380	61/207 (29%)
		LRR_8	328..388	CDD:290566	18/58 (31%)
		leucine-rich repeat	330..353	CDD:275380	7/22 (32%)
		leucine-rich repeat	354..377	CDD:275380	8/22 (36%)
		leucine-rich repeat	378..401	CDD:275380	8/22 (36%)
		leucine-rich repeat	402..425	CDD:275380	8/22 (36%)
		leucine-rich repeat	428..451	CDD:275380	7/22 (32%)
		LRR_8	429..487	CDD:290566	17/76 (22%)
		leucine-rich repeat	452..473	CDD:275380	6/24 (25%)
		leucine-rich repeat	477..497	CDD:275378	6/34 (18%)
		LRR_8	498..558	CDD:290566	7/19 (37%)
		leucine-rich repeat	500..523	CDD:275380	6/17 (35%)
		LRR_RI	502..769	CDD:238064	5/15 (33%)
		leucine-rich repeat	524..547	CDD:275380
		leucine-rich repeat	548..571	CDD:275380
		LRR_8	572..630	CDD:290566
		leucine-rich repeat	572..595	CDD:275380
		leucine-rich repeat	596..619	CDD:275380
		LRR_8	619..678	CDD:290566
		leucine-rich repeat	620..643	CDD:275380
		leucine-rich repeat	644..667	CDD:275380
		LRR_8	666..726	CDD:290566
		leucine-rich repeat	668..691	CDD:275380
		leucine-rich repeat	692..715	CDD:275380
		LRR_8	714..774	CDD:290566
		leucine-rich repeat	716..739	CDD:275380
		leucine-rich repeat	740..761	CDD:275380
		leucine-rich repeat	764..789	CDD:275380
		leucine-rich repeat	790..810	CDD:275380
		leucine-rich repeat	818..850	CDD:275380
		leucine-rich repeat	863..883	CDD:275378
		LRR_RI	<878..1070	CDD:238064
		LRR_8	884..944	CDD:290566
		LRR_4	884..925	CDD:289563
		leucine-rich repeat	884..907	CDD:275380
		leucine-rich repeat	908..933	CDD:275380
		leucine-rich repeat	934..955	CDD:275380
		leucine-rich repeat	958..982	CDD:275380
		leucine-rich repeat	983..1055	CDD:275380
		leucine-rich repeat	1009..1033	CDD:275380
		leucine-rich repeat	1058..1085	CDD:275380
		TPKR_C2	1121..1168	CDD:301599
Islr2	NP_001155007.1	leucine-rich repeat	80..96	CDD:275380	61/207 (29%)
		LRR_8	96..155	CDD:290566	18/58 (31%)
		leucine-rich repeat	97..120	CDD:275380	7/22 (32%)
		leucine-rich repeat	121..144	CDD:275380	8/22 (36%)
		LRR_4	144..183	CDD:289563	12/38 (32%)
		leucine-rich repeat	145..168	CDD:275380	8/22 (36%)
		LRR_8	164..227	CDD:290566	22/64 (34%)
		LRR_4	169..208	CDD:289563	13/40 (33%)
		leucine-rich repeat	169..192	CDD:275380	8/24 (33%)
		leucine-rich repeat	193..216	CDD:275380	7/22 (32%)
		LRRCT	225..273	CDD:214507	8/49 (16%)
		Ig_2	288..417	CDD:290606	3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24366
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100