DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and Islr2

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_001155007.1 Gene:Islr2 / 320563 MGIID:2444277 Length:789 Species:Mus musculus


Alignment Length:207 Identity:61/207 - (29%)
Similarity:97/207 - (46%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 SLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPG 393
            ::.:|.:|.|.||.:..|.|..:..:..|.|:.:.:||:|..||..|..|:.|.:..|.|...|.
Mouse    96 NVTTLSLSANKITVLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNLISNFPW 160

  Fly   394 SALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLS 458
            |.|..|..|..|::::||:.:|..:.||:|.  |:.:|.::.|.:|.|.||:|...|:|..|.|.
Mouse   161 SDLRNLSALQLLKMNHNRLGSLPRDALGALP--DLRSLRINNNRLRTLEPGTFDALSALSHLQLY 223

  Fly   459 GN----SLAVINADTFAGLESTLMALK---------------LSQNRLTGLGGAPWVLPELRSLD 504
            .|    |..::....:|.  ||.::|.               :..:||..|..||   |.:|   
Mouse   224 HNPFHCSCGLVWLQAWAA--STRVSLPEPDSIACASPPELQGVPVHRLPALPCAP---PSVR--- 280

  Fly   505 LSGNTLTELPST 516
            ||.....|.|.|
Mouse   281 LSAEPPPEAPGT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 25/80 (31%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 61/207 (29%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380 61/207 (29%)
leucine-rich repeat 330..353 CDD:275380 7/22 (32%)
leucine-rich repeat 354..377 CDD:275380 8/22 (36%)
leucine-rich repeat 378..401 CDD:275380 8/22 (36%)
leucine-rich repeat 402..425 CDD:275380 8/22 (36%)
leucine-rich repeat 428..451 CDD:275380 7/22 (32%)
leucine-rich repeat 452..473 CDD:275380 6/24 (25%)
leucine-rich repeat 477..497 CDD:275378 6/34 (18%)
leucine-rich repeat 500..523 CDD:275380 6/17 (35%)
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
Islr2NP_001155007.1 leucine-rich repeat 80..96 CDD:275380 61/207 (29%)
LRR <95..>227 CDD:443914 44/132 (33%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
leucine-rich repeat 169..192 CDD:275380 8/24 (33%)
leucine-rich repeat 193..216 CDD:275380 7/22 (32%)
PCC 198..>272 CDD:188093 18/75 (24%)
Ig_3 276..404 CDD:464046 8/23 (35%)
Ig <395..417 CDD:472250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.