DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and TSKU

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_001305406.1 Gene:TSKU / 25987 HGNCID:28850 Length:367 Species:Homo sapiens


Alignment Length:441 Identity:111/441 - (25%)
Similarity:159/441 - (36%) Gaps:166/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GLKDSLNELRLANNLLGDNLNPI---FSTAELHVLKNLRLLDLSGNKIKLIEEGLLKGCMDLKEF 189
            ||.||.:..|:..:.||.::.|:   ..||.         ||||.|:::::.|.:|.|       
Human    46 GLFDSFSLTRVDCSGLGPHIMPVPIPLDTAH---------LDLSSNRLEMVNESVLAG------- 94

  Fly   190 YIDRNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKG 254
                           .|.:.|..|                        ||.||::.||...|   
Human    95 ---------------PGYTTLAGL------------------------DLSHNLLTSISPTA--- 117

  Fly   255 LQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQL 319
                                 |.:|:.|:.||||.|.....|..:..:.| |..:|||.|.|:::
Human   118 ---------------------FSRLRYLESLDLSHNGLTALPAESFTSSP-LSDVNLSHNQLREV 160

  Fly   320 DY----THMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQT 380
            ..    ||.| .|:|. :|:|.|.|..:.|...|                       .||.:   
Human   161 SVSAFTTHSQ-GRALH-VDLSHNLIHRLVPHPTR-----------------------AGLPA--- 197

  Fly   381 LIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGS 445
                               |.:.||.|.:||:.|:..                    :|:||   
Human   198 -------------------PTIQSLNLAWNRLHAVPN--------------------LRDLP--- 220

  Fly   446 FQMFSSLHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPW-VLPELRSLDLSGN- 508
                  |..|.|.||.||||....||||.........|..||..|..:.: .||.|:.|||||| 
Human   221 ------LRYLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVLDLSGNP 279

  Fly   509 TLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIR 559
            .|....:.:|..|.::|.|:|||.:|.||..||...|..||.:.: |.::|
Human   280 KLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLLHLPALQSVSV-GQDVR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 61/288 (21%)
leucine-rich repeat 109..132 CDD:275380 2/3 (67%)
leucine-rich repeat 133..161 CDD:275380 6/30 (20%)
leucine-rich repeat 162..185 CDD:275380 8/22 (36%)
leucine-rich repeat 186..209 CDD:275380 1/22 (5%)
leucine-rich repeat 210..233 CDD:275380 2/22 (9%)
leucine-rich repeat 234..257 CDD:275380 7/22 (32%)
PLN00113 237..>750 CDD:215061 90/329 (27%)
leucine-rich repeat 258..281 CDD:275380 2/22 (9%)
leucine-rich repeat 282..329 CDD:275380 17/50 (34%)
leucine-rich repeat 330..353 CDD:275380 7/22 (32%)
leucine-rich repeat 354..377 CDD:275380 2/22 (9%)
leucine-rich repeat 378..401 CDD:275380 0/22 (0%)
leucine-rich repeat 402..425 CDD:275380 6/22 (27%)
leucine-rich repeat 428..451 CDD:275380 3/22 (14%)
leucine-rich repeat 452..473 CDD:275380 11/20 (55%)
leucine-rich repeat 477..497 CDD:275378 4/20 (20%)
leucine-rich repeat 500..523 CDD:275380 10/23 (43%)
leucine-rich repeat 524..547 CDD:275380 11/22 (50%)
leucine-rich repeat 548..571 CDD:275380 4/12 (33%)
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
TSKUNP_001305406.1 leucine-rich repeat 76..99 CDD:275380 9/53 (17%)
LRR <98..>321 CDD:443914 89/347 (26%)
leucine-rich repeat 100..123 CDD:275380 11/70 (16%)
leucine-rich repeat 124..145 CDD:275380 7/20 (35%)
leucine-rich repeat 147..170 CDD:275380 8/22 (36%)
leucine-rich repeat 171..197 CDD:275380 10/49 (20%)
leucine-rich repeat 200..219 CDD:275380 7/38 (18%)
leucine-rich repeat 221..244 CDD:275380 13/22 (59%)
leucine-rich repeat 245..269 CDD:275380 5/23 (22%)
leucine-rich repeat 270..294 CDD:275380 10/23 (43%)
leucine-rich repeat 295..316 CDD:275380 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.