DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and dma-1

DIOPT Version :9

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:428 Identity:114/428 - (26%)
Similarity:182/428 - (42%) Gaps:84/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PSALR--HLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRIS 269
            |..||  |:....|:|||                   |.:|..|::  ....::|.::|...:|.
 Worm    59 PLTLRSLHIQPPSNRIGS-------------------NKLRWNDNI--NRFAQLRVLRLINCQIP 102

  Fly   270 HLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLD 334
            .::..:  :|.||:.|||..|............:|.|:.|:||||.|..|.......:|:|.||.
 Worm   103 AMSRSI--RLPSLEVLDLHSNNIEHATMSNFGGMPKLRVLDLSSNHLNILPTGVFTYLRALRSLS 165

  Fly   335 ISRNTITTITPGTFREMGALKYLDLSLNSLRTIE--DDALEGLDSLQTLIIKDNNILLVPGSALG 397
            :|.|||:.::....|.:.:|:.|.|..|.: .||  ::....:..|..|.:...|:..:...||.
 Worm   166 LSNNTISDLSTNLLRGLNSLRVLRLDRNPI-PIEHINELFTDVSQLDELYLNHCNLSSIYSLALD 229

  Fly   398 RLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSL 462
            |:|||..|.:..|.:..:..:.|.||.  .::.|.||.|.|:|:...:| ..:::..||||.|.|
 Worm   230 RIPQLRQLGIGGNNLKMVPTKELRSLP--QLSVLDLSHNSIQEITACAF-CNTNISKLDLSHNLL 291

  Fly   463 AV-----INADTFAGLESTLMALKLSQNRLTG-----LGGAPWVLPELRSLDLSGNTL------- 510
            .:     .|.|.|..:  .|..|.||.|.:..     ||   |...||.|:.||||.|       
 Worm   292 GISKDSPFNEDAFRTM--PLRHLDLSFNHMNDFDSKWLG---WAQEELTSIALSGNFLKNFEESW 351

  Fly   511 ---------------------TELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLS 554
                                 .:|||..:    ::.|||:|||.||.|...:...|..::..|::
 Worm   352 TYTLKSLIHLELAYNHIKFIPVQLPSRYY----HLISLNISGNELTYLPDNINTLLPNVKTFDIT 412

  Fly   555 GCNIRQISGDLLAGLQDLKHIYLNDN------QLQELQ 586
            .......|...||.|.:::.:|::.|      .:|.||
 Worm   413 ANRFHTFSHTDLAFLNNVEQVYVDGNPWDCSCAIQGLQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 35/132 (27%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566 5/14 (36%)
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380 1/1 (100%)
leucine-rich repeat 210..233 CDD:275380 7/24 (29%)
LRR_8 232..290 CDD:290566 12/57 (21%)
leucine-rich repeat 234..257 CDD:275380 3/22 (14%)
leucine-rich repeat 258..281 CDD:275380 4/22 (18%)
LRR_RI 273..535 CDD:238064 86/301 (29%)
LRR_8 281..338 CDD:290566 20/56 (36%)
leucine-rich repeat 282..329 CDD:275380 14/46 (30%)
LRR_8 328..388 CDD:290566 17/61 (28%)
leucine-rich repeat 330..353 CDD:275380 8/22 (36%)
leucine-rich repeat 354..377 CDD:275380 6/24 (25%)
leucine-rich repeat 378..401 CDD:275380 6/22 (27%)
leucine-rich repeat 402..425 CDD:275380 6/22 (27%)
leucine-rich repeat 428..451 CDD:275380 7/22 (32%)
LRR_8 429..487 CDD:290566 21/62 (34%)
leucine-rich repeat 452..473 CDD:275380 9/25 (36%)
leucine-rich repeat 477..497 CDD:275378 8/24 (33%)
LRR_8 498..558 CDD:290566 22/87 (25%)
leucine-rich repeat 500..523 CDD:275380 10/50 (20%)
LRR_RI 502..769 CDD:238064 29/119 (24%)
leucine-rich repeat 524..547 CDD:275380 10/22 (45%)
leucine-rich repeat 548..571 CDD:275380 5/22 (23%)
LRR_8 572..630 CDD:290566 5/21 (24%)
leucine-rich repeat 572..595 CDD:275380 5/21 (24%)
leucine-rich repeat 596..619 CDD:275380
LRR_8 619..678 CDD:290566
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
LRR_8 666..726 CDD:290566
leucine-rich repeat 668..691 CDD:275380
leucine-rich repeat 692..715 CDD:275380
LRR_8 714..774 CDD:290566
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
LRR_RI <878..1070 CDD:238064
LRR_8 884..944 CDD:290566
LRR_4 884..925 CDD:289563
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 17/58 (29%)
leucine-rich repeat 91..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 5/22 (23%)
LRR 136..430 CDD:227223 87/306 (28%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..209 CDD:275380 6/24 (25%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
leucine-rich repeat 234..257 CDD:275380 6/24 (25%)
leucine-rich repeat 258..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..307 CDD:275380 9/25 (36%)
leucine-rich repeat 309..357 CDD:275380 16/50 (32%)
leucine-rich repeat 382..405 CDD:275380 10/22 (45%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
TPKR_C2 438..>478 CDD:387596 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.