DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and LRRN4

DIOPT Version :9

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_689824.2 Gene:LRRN4 / 164312 HGNCID:16208 Length:740 Species:Homo sapiens


Alignment Length:314 Identity:95/314 - (30%)
Similarity:134/314 - (42%) Gaps:73/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 RSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLV- 391
            |:||.|           ||....  .|:.||.|.|.||.:....|..|:.||.|.::.|.|..: 
Human    64 RNLERL-----------PGCLPR--TLRSLDASHNLLRALSTSELGHLEQLQVLTLRHNRIAALR 115

  Fly   392 --PGSALGRLPQLTSLQLDYNRVAAL---SAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSS 451
              ||...|    |.:|.|.||::|||   :...|.||:|     |:|:.|.:|.|.|.:|..|.:
Human   116 WGPGGPAG----LHTLDLSYNQLAALPPCTGPALSSLRA-----LALAGNPLRALQPRAFACFPA 171

  Fly   452 LHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPWVLPELRSLDLSGNTLTELPST 516
            |..|:||..:|.       .|.:.     .:::....|..|||.|..|:  |||||..|..:.|.
Human   172 LQLLNLSCTALG-------RGAQG-----GIAEAAFAGEDGAPLVTLEV--LDLSGTFLERVESG 222

  Fly   517 IFEELENVQSLNL-SGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISGDLLAGLQDLKHIYLNDN 580
            ...:|..:.||.| ....||.|.|.:||....||.:|   |.    ....||.:  ..||:.:..
Human   223 WIRDLPKLTSLYLRKMPRLTTLEGDIFKMTPNLQQLD---CQ----DSPALASV--ATHIFQDTP 278

  Fly   581 QLQELQDGSFVNLWNISSI---DLSNNRIGSIRSGAFVNVMKLQKLDLHGNQLS 631
            .||.|   .|.|. |:||.   .|.::::.||              :|.||.|:
Human   279 HLQVL---LFQNC-NLSSFPPWTLDSSQVLSI--------------NLFGNPLT 314

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 4/9 (44%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
LRR_8 232..290 CDD:290566
leucine-rich repeat 234..257 CDD:275380
leucine-rich repeat 258..281 CDD:275380
LRR_RI 273..535 CDD:238064 66/213 (31%)
LRR_8 281..338 CDD:290566 4/9 (44%)