DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and LOC1269758

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:XP_308407.5 Gene:LOC1269758 / 1269758 VectorBaseID:AGAMI1_000122 Length:351 Species:Anopheles gambiae


Alignment Length:307 Identity:74/307 - (24%)
Similarity:123/307 - (40%) Gaps:97/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 PELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQV--IDLSGCN--- 557
            |:.|.:.:..:|:.....::|..|.:|::|                .:.|||:  :||:||:   
Mosquito    46 PDERLVWIRNSTIPVFNRSLFTPLAHVENL----------------MIHRLQIEQLDLAGCDKLD 94

  Fly   558 --------IRQISGDLLAGLQDLKHIYLNDNQLQELQDGSFVNLWNISSIDLSNNRIGSIRSGAF 614
                    |.::|.|  .|| .|:.::|..|:|.::  .:...|..|..:.|..|.:.|:|...|
Mosquito    95 ILFASYNAIDRVSAD--EGL-PLRQLHLYQNRLTDV--SALRALTEIEQLYLHENLLESLRFDTF 154

  Fly   615 VNVMKLQKLDLHGNQLSAFKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFS 679
            ..:..|:.|.|..|:|....     ||||.:.|                :.||            
Mosquito   155 APMRHLKILTLQRNRLRTIA-----TGTGNKPL----------------VMPR------------ 186

  Fly   680 FFPAELISTLQYLEHIDLSHNQLKTIEELDFARLPRLRVLLVANNQLDMVSEMAF-HNSTQLQIL 743
                        ||.:.|..|||..: :....|:.|||||.|::|||..:  :.| .....|:.|
Mosquito   187 ------------LEQLFLQFNQLPHL-DTGLWRMERLRVLDVSHNQLAYL--LTFLEELPALRTL 236

  Fly   744 DLAHN---------NLDRIGERTF----EGLVRL-EQLNLEGNRLSE 776
            .|.||         .|:|:|.|..    :||:.: |:.:..|.||.:
Mosquito   237 GLHHNPWHCGWLFGMLERLGARELDTDADGLIGIDEEASCPGLRLED 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 64/274 (23%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380 4/22 (18%)
leucine-rich repeat 524..547 CDD:275380 2/22 (9%)
leucine-rich repeat 548..571 CDD:275380 11/35 (31%)
leucine-rich repeat 572..595 CDD:275380 5/22 (23%)
leucine-rich repeat 596..619 CDD:275380 6/22 (27%)
leucine-rich repeat 620..643 CDD:275380 7/22 (32%)
leucine-rich repeat 644..667 CDD:275380 1/22 (5%)
leucine-rich repeat 668..691 CDD:275380 0/22 (0%)
LRR <684..1020 CDD:443914 32/108 (30%)
leucine-rich repeat 692..715 CDD:275380 7/22 (32%)
leucine-rich repeat 716..739 CDD:275380 9/23 (39%)
leucine-rich repeat 740..761 CDD:275380 9/33 (27%)
leucine-rich repeat 764..789 CDD:275380 4/14 (29%)
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
LOC1269758XP_308407.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.