DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TkR99D and ora3

DIOPT Version :9

Sequence 1:NP_001263092.1 Gene:TkR99D / 43551 FlyBaseID:FBgn0004622 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_009294044.1 Gene:ora3 / 100004895 ZFINID:ZDB-GENE-100721-3 Length:361 Species:Danio rerio


Alignment Length:357 Identity:73/357 - (20%)
Similarity:130/357 - (36%) Gaps:89/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ILFGGMVIVATGGNLIVVWIVMTTKRMRTVT----NYFIVNLSIADAMVSSLNVTFNYYYMLDSD 166
            :|:..:|::...||..|:.:|..:....|.|    :..:||::.::.|||.|..|    .::.||
Zfish    22 MLYVVLVLLGNAGNTTVIAVVGQSLLQETGTVRSSDVILVNMAFSNLMVSLLRNT----VLMVSD 82

  Fly   167 WPFGEFYCK-LSQFIAMLSI---CASVFTLMAISIDRYVAIIR----------PLQPRMSKRCNL 217
            .....|..: :.||:..|.:   .|:|::...:|...:..:.|          |..|.:|.....
Zfish    83 LGVEIFLSRDMCQFMMGLWVWVRSANVWSTFFLSAFHFQTLRRVAPPVINLHGPRGPPLSLILGF 147

  Fly   218 AIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTV---CYPEWPDGPTNHSTM----------- 268
            .:   ||..:.:.|.|..|..:      .|..|.|.   |    |....|.|.:           
Zfish   148 CL---IWSLNLIYSIPAFIFSK------NGNENSTEGSGC----PGSAPNISRLLFSWISLTVYL 199

  Fly   269 ------------------------ESLYNILI-----IILTYFLPIVSMTVTY--SRVGIELWGS 302
                                    .|.|:.|.     :||...:||..|.:|.  |...:...|.
Zfish   200 WCVLQTLMLVSSTTRPLLGCIWDFPSAYSGLAFATSSMILHESIPICLMNITNLGSLCTLYAHGH 264

  Fly   303 K-TI---GECTPRQVENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAPFIQELY 363
            | |:   ||..| .|..:.::||..|:::.:.::|...|    ...:|:..|.........:.|.
Zfish   265 KRTVASQGEDAP-VVSRIPAERRAAKVILALNILFISSW----GTNVISVNYFNYNRGQSTEFLL 324

  Fly   364 LAIYWLAMSNSMYNPIIYCWMNSRFRYGFKMV 395
            :...::.||...::|||....:.:.|...|.|
Zfish   325 IIARFVNMSFIAFSPIILAVGHRKLRAFIKSV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TkR99DNP_001263092.1 7tm_4 113..396 CDD:304433 71/350 (20%)
7tm_1 118..381 CDD:278431 67/329 (20%)
ora3XP_009294044.1 TAS2R 19..>120 CDD:283059 24/101 (24%)
7tm_1 34..>210 CDD:278431 38/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.