DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps13B and LOC103910901

DIOPT Version :9

Sequence 1:NP_651753.2 Gene:Vps13B / 43550 FlyBaseID:FBgn0039727 Length:3731 Species:Drosophila melanogaster
Sequence 2:XP_021322459.1 Gene:LOC103910901 / 103910901 -ID:- Length:401 Species:Danio rerio


Alignment Length:422 Identity:81/422 - (19%)
Similarity:138/422 - (32%) Gaps:151/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   901 STISASAIAFNDFQPRRISRNNSRKISVPEETVHLSSERDERHTQAEPLTIPVANKP-------- 957
            :::.::|:.      |:.|..||...|.|.:|        :..|::.||:|||...|        
Zfish    11 ASVGSAALT------RQASNQNSDYTSSPVKT--------KTVTESRPLSIPVKVFPSAEECPVS 61

  Fly   958 ---QPSNF--DTTDFVKRLTKMVVLVEIAQAKIDVCEVMMRK-------------TPGHTDVEYT 1004
               |..|.  .|.:.||.||        .|.::..|.|.:..             .||.....|.
Zfish    62 PEEQMKNLITHTWNAVKHLT--------LQVELQSCCVFLPSDTLPSPSTLVCGDVPGTVRSWYH 118

  Fly  1005 S---------IRLPHMKVKSG---NCEAIQRGNIRGVIPVASNTELLNWVFDLNEFNVCYRRANV 1057
            |         :.||.:.|.|.   ..|.:|.|.:....||........|       .||.|:.:|
Zfish   119 SQVCMPGTLVVCLPQISVLSAGHRRMEPLQDGPLTVPRPVLEEGGAFPW-------TVCVRQLSV 176

  Fly  1058 TEM--------IIAPVRTTITLALSFKTSDKVDGSKGKEDKCANTCSINVHVDMSAI-------- 1106
            ..:        ::.|:..|.||||   |:.::      :....:...|.:|||:..:        
Zfish   177 YSLLGHQRSLSVVDPLGCTSTLAL---TAPRL------QPAARDAFIICLHVDLQPLQLQCSNPQ 232

  Fly  1107 ------------NIF----------AQRVKLLHEHCLI--------ISKMYGSLCPDEPASKWQT 1141
                        .||          |||.......|..        :....|:..||       |
Zfish   233 VQLVCALWCRWMQIFSVLERLQTRGAQRAAAGFPECSAPAAGPASPVHSSAGTAPPD-------T 290

  Fly  1142 GKMKPRLEVYT-----GSAQNYPVIKEFLELDPNFEAPKVKSAPKSS--VILFCQWTIPRISFEM 1199
            ....|..::.|     .:..:.|...|.|.|:     .:..|...||  :.::.||.:||::.::
Zfish   291 STCSPSADLGTPTEADSAHTDDPAAGETLTLE-----QQTCSISGSSRRLSVWMQWMLPRLTLKL 350

  Fly  1200 ENS----------NDFKHSKIVMSLEDLLLNI 1221
            .:|          |...|:......:::.|::
Zfish   351 FSSEPASRTTGTHNTHTHTHTHTQKQEVALSV 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps13BNP_651753.2 Chorein_N 5..117 CDD:289396
VPS13_C 3319..3468 CDD:293514
ATG_C 3473..3546 CDD:286423
LOC103910901XP_021322459.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D51820at33208
OrthoFinder 1 1.000 - - FOG0008361
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106252
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.