DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPP2 and SPBC1198.05

DIOPT Version :9

Sequence 1:XP_011523129.2 Gene:MPP2 / 4355 HGNCID:7220 Length:630 Species:Homo sapiens
Sequence 2:NP_595074.1 Gene:SPBC1198.05 / 2539674 PomBaseID:SPBC1198.05 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:202 Identity:54/202 - (26%)
Similarity:99/202 - (49%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   421 ARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEM 485
            :::...:.|.:|:.|..|||:.:|..:|:....|:.|.:|.:|:|.|:..|::|..|.||::.|.
pombe    11 SKLVTLKLKPVVVFGPSGVGKSTLLKRLLKDHGDKLGFSVSHTTRTPRAGEKDGIDYHFVTKEEF 75

Human   486 EADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPD 550
            :..|...:::|...:.||:|||.|.:|:.:.|..|..:||::.|.|..::.:......||:..|.
pombe    76 QKLVAEEKFVEWAVFSGNMYGTSIMAIQELEAVNKKAILDIDLQGVLQVKASPIDAQYVFLAPPS 140

Human   551 FETLRAMNRAALESGISTKQLTEADLRRTVEESSRIQR--------GYGH---YFDLCLVNSNLE 604
            .|.|....|.                |.|..||:.:||        .|..   .||..:||.::|
pombe   141 IEQLEVRLRG----------------RGTENESAILQRLERARAEIEYSEKPGNFDALIVNDDVE 189

Human   605 RTFRELQ 611
            :.:::|:
pombe   190 KAYKQLE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPP2XP_011523129.2 None
SPBC1198.05NP_595074.1 Gmk 17..201 CDD:223272 54/196 (28%)
guanyl_kin 19..201 CDD:213788 54/194 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.