DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Balpha and Eif2b2

DIOPT Version :9

Sequence 1:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_114447.2 Gene:Eif2b2 / 84005 RGDID:620820 Length:351 Species:Rattus norvegicus


Alignment Length:279 Identity:73/279 - (26%)
Similarity:128/279 - (45%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IRTLLMILEKKQFGTIHILHTTMREAVAAMRNTDLSIAAIVSAGELFCRFITLSLDDKHMEECRQ 98
            :|.:|.|: ::::|.:|        ..:...:...|:..::::|.|...|      ..|....:.
  Rat    82 VRRVLKII-REEYGRLH--------GRSDESDQQESLHKLLTSGGLSEDF------SFHYAPLKS 131

  Fly    99 IMLNRGKIFLTKLLNSRQVIAQQAQRFITDGCRILTHSRSRVVLKALITASQNKKSFHVYVTQGG 163
            .::......|.:|..:.:.||.||...|.....|:|...||.| :|.:..:..|:.|||...:..
  Rat   132 NIIEAINELLVELEGTTENIAAQALEHIHSNEVIMTIGFSRTV-EAFLREAAQKRKFHVIAAECA 195

  Fly   164 TGNSGEEMVKDLHAAGIDCTLILDSATGYVMESVDFVLVGAEAVVESGGIINRIGTYTMGLCARE 228
            ....|.||..:|..|||:.|::.|:|...||..|:.|::|.:.::.:|.:....||:|:.|.|:.
  Rat   196 PFCQGHEMAVNLSEAGIETTVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLALAAKH 260

  Fly   229 MKKPFYVLAESFKFSRLYPLNQRDL-----PNE-YKYSRKHLNDVSKVH-PLVDYTPPVYITLLF 286
            ...|..|.|..||.|..:|..:...     |.| ..::...:.:...|| |:.||.||..|||..
  Rat   261 HSTPLIVCAPMFKLSPQFPSEEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPDLITLFI 325

  Fly   287 TDLGRLTPSAVSDELIKLY 305
            :::|...||.|...:.:||
  Rat   326 SNIGGNAPSYVYRLMSELY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 68/266 (26%)
GCD2 31..305 CDD:224105 71/277 (26%)
Eif2b2NP_114447.2 GCD2 13..344 CDD:224105 71/277 (26%)
IF-2B 29..333 CDD:279362 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.