DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Balpha and eif2b4

DIOPT Version :9

Sequence 1:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_005160517.1 Gene:eif2b4 / 541548 ZFINID:ZDB-GENE-030131-955 Length:555 Species:Danio rerio


Alignment Length:219 Identity:61/219 - (27%)
Similarity:107/219 - (48%) Gaps:20/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MEECRQIMLNRGKIFLTKLLNSRQVIAQQAQRFITDGCRILTHSRSRVVLKALITASQNKKSFHV 157
            ::.|....:|.      |::.:.:.|::.|...|::|..||.:..|.:|...|..|.:.::.|.|
Zfish   332 LQACIDSYINE------KIILASEAISKYAIEKISNGDVILVYGCSSLVNHILCEAFEKQRQFRV 390

  Fly   158 YVTQGGTGNSGEEMVKDLHAAGIDCTLILDSATGYVMESVDFVLVGAEAVVESGGIINRIGTYTM 222
            .|........|.|.::.|...||.||.:|.||..|::..|..|.:||.|::.:|.:::|:||..:
Zfish   391 IVVDSRPRLEGREALRRLVKKGIRCTYVLISALSYILPEVSKVFLGAHALLANGYVMSRVGTSQI 455

  Fly   223 GLCAREMKKPFYVLAESFKF-----SRLYPLNQRDLPNEYKYSRK---HLNDVSKVHPL------ 273
            .|.|:....|..|..|::||     :..:..|:.|.|::...:|.   ||.:...|..|      
Zfish   456 ALVAKAYNVPVLVCCETYKFCERVQTDSFVSNELDDPDDLIVTRNGKTHLENWQTVKSLGLLNLV 520

  Fly   274 VDYTPPVYITLLFTDLGRLTPSAV 297
            .|.|||.::.|:.||||.:..::|
Zfish   521 YDVTPPDFVDLVITDLGMIPCTSV 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 60/214 (28%)
GCD2 31..305 CDD:224105 61/219 (28%)
eif2b4XP_005160517.1 GCD2 235..549 CDD:224105 61/219 (28%)
IF-2B 251..541 CDD:279362 60/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.