DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Balpha and eIF2Bbeta

DIOPT Version :9

Sequence 1:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster


Alignment Length:340 Identity:76/340 - (22%)
Similarity:137/340 - (40%) Gaps:73/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DVVKYFLQ-------------LLDEDKDLSSGI------AAIRTLLMILEKKQFGTIHI------ 51
            |:.||.:.             :.|:.|.|.:.:      :.|...::.|.:::|..:|.      
  Fly    33 DIFKYIIMSKSWQNADALMQIVRDQCKILQAALPQETVTSNIARRILKLTREEFDLLHAKVQHFA 97

  Fly    52 --------LHTTMREAVAAMRNTDLSIAAIVSAGELFCRFITLSLDDKHMEECRQIMLNRGKIFL 108
                    ||..:.:...:..:.|.|:.                     ....|:.:|:..:...
  Fly    98 DDSQASLSLHKLVTQTSESNVSVDYSVP---------------------QHGLREALLDHLQEVE 141

  Fly   109 TKLLNSRQVIAQQAQRFITDGCRILTHSRSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVK 173
            |:|..|.:.|..||:..|.....|||...||.|...|..|.:.::...:.|.:......|..:..
  Fly   142 TELETSSENICVQAEEHIHSSEIILTLGHSRSVENFLKRAIKKRQFLTIIVAECAPACRGHNLAA 206

  Fly   174 DL-HAAGIDCTLILDSATGYVMESVDFVLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLA 237
            .| :...::..:|.|:|...:|..|:.|::|..:|:.:||:....|.||:.|.|:....|..|||
  Fly   207 SLANEKNVEIVVIPDAAIFAMMSRVNKVIIGTHSVLANGGLRAACGAYTVALAAKHYSVPVIVLA 271

  Fly   238 ESFKFSRLYPLNQRD-----------LPNEYKYSRKHLNDVSKVH-PLVDYTPPVYITLLFTDLG 290
            ..:|.|.|: |.::|           :|.:...:|:     :||: |:.||.||..:||..::.|
  Fly   272 PMYKLSPLH-LCEQDAFNMVGCAEDVIPYDSIPARE-----AKVYSPMFDYVPPELVTLFISNTG 330

  Fly   291 RLTPSAVSDELIKLY 305
            ...||.|...|.:||
  Fly   331 GHAPSYVYRLLTELY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 64/296 (22%)
GCD2 31..305 CDD:224105 68/306 (22%)
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 74/338 (22%)
IF-2B 21..334 CDD:279362 70/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.