DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Balpha and Eif2b4

DIOPT Version :9

Sequence 1:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001120827.1 Gene:Eif2b4 / 13667 MGIID:95300 Length:544 Species:Mus musculus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:118/248 - (47%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAIVSAGELFCRFITLSLDDKHMEECRQIMLNRGKIFLTKLLNSRQVIAQQA-QRF----ITDGC 130
            |::.:|.:...:.:|.....|..||.:..:    :..|.:.:..:.|:|.|| .||    |:||.
Mouse   292 ASMCNAIKFLTKEVTGMSSSKREEEAKSEL----REALDRYVQEKIVLAAQAISRFASTKISDGD 352

  Fly   131 RILTHSRSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHAAGIDCTLILDSATGYVME 195
            .||.:..|.:|.:.|..|....:.|.|.|........|..|:..|..||:..:.:|..|..||:.
Mouse   353 VILVYGCSSLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLP 417

  Fly   196 SVDFVLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLAESFKF-----SRLYPLNQRDLPN 255
            .|..||:||.|::.:|.:::|:||..:.|.||....|..|..|::||     :..:..|:.|.|:
Mouse   418 EVSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPD 482

  Fly   256 EYKYSRKHLNDVS----KVHP-------LVDYTPPVYITLLFTDLGRLTPSAV 297
            :.:..|.  :.|:    :.||       :.|.|||..:.|:.|:||.:..|:|
Mouse   483 DLQCKRG--DQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSV 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 67/243 (28%)
GCD2 31..305 CDD:224105 69/248 (28%)
Eif2b4NP_001120827.1 GCD2 240..538 CDD:224105 69/248 (28%)
IF-2B 240..530 CDD:279362 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.