DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Balpha and Eif2b4

DIOPT Version :9

Sequence 1:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_038967625.1 Gene:Eif2b4 / 117019 RGDID:620208 Length:544 Species:Rattus norvegicus


Alignment Length:242 Identity:64/242 - (26%)
Similarity:118/242 - (48%) Gaps:15/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAIVSAGELFCRFITLSLDDKHMEECRQIMLNR-GKIFLTKLLNSRQVIAQQAQRFITDGCRILT 134
            |::.:|.:.|.:.:|.....|..||.:..:... .:....|::.:.|.|::.|.:.|:||..||.
  Rat   292 ASMCNAIKFFNKEVTGMSSSKREEEAKSELKEAIDRYVQEKIVLASQAISRFASKKISDGDVILV 356

  Fly   135 HSRSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHAAGIDCTLILDSATGYVMESVDF 199
            :..|.:|.:.|..|....:.|.|.|........|..|:..|..||:..:.:|..|..||:..|..
  Rat   357 YGCSSLVSRILQEAWVEGRRFRVVVVDSRPRLEGRHMLHCLVRAGVPTSYLLIPAASYVLPEVSK 421

  Fly   200 VLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLAESFKF-----SRLYPLNQRDLPNEYKY 259
            ||:||.|::.:|.:::|:||..:.|.||....|..|..|::||     :..:..|:.|.|::.:.
  Rat   422 VLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQC 486

  Fly   260 SR---------KHLNDVSKVHPLVDYTPPVYITLLFTDLGRLTPSAV 297
            .|         ::.:.:..::.:.|.|||..:.|:.|:||.:..|:|
  Rat   487 KRGDQVTLANWQNNSSLRLLNLVYDVTPPELVDLVITELGMIPCSSV 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 62/237 (26%)
GCD2 31..305 CDD:224105 64/242 (26%)
Eif2b4XP_038967625.1 IF-2B 240..530 CDD:395798 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.