DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:244 Identity:64/244 - (26%)
Similarity:107/244 - (43%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHC---------TAGADEA 92
            |:|.|..|.:.....:.:...||:.::.....||||:|...||||||||         ..|..:.
Zfish    36 IDGDIHEGIMQGVDALRWPWQVSIKTSSGEHLCGGSLINKFWVLTAAHCQIQARSHYVVLGQHDR 100

  Fly    93 SLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIK-TPHVDFYSLVNKIELPSLDDRYNS 156
            |...|.|...|.|...|....|.     ....::|:.|:| :......|||:.:.|.|...:.  
Zfish   101 SSNDGTVQVKEIAKVITHPDNNI-----QTLFNNDVTLLKLSSPAQMTSLVSPVCLASSSSKI-- 158

  Fly   157 YENNWVQAAGWGAIYD--GSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQ 219
            .........|||....  .:.::::   ..:.::|.::|:..:|....:.:.||. ...|.::||
Zfish   159 VPGTLCVTTGWGRTKTELSARILQE---ATIPIVSQSQCKQIFGASKITNSMICA-GGSGSSSCQ 219

  Fly   220 GDSGGPLVTKEGD--KLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKE 266
            |||||||:.:...  ..:||.|:.:. .|:|..|..:.||:.:.:||.|
Zfish   220 GDSGGPLMCESSGVWYQVGIVSWGNR-DCRVDFPLVYARVSYFRKWIDE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 59/237 (25%)
Tryp_SPc 41..266 CDD:238113 61/238 (26%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 60/228 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.