DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Prss22

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:245 Identity:72/245 - (29%)
Similarity:117/245 - (47%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHC-TAGADEASLY---YGAVN 100
            ||..|..:.:.|.|:||.:..|.:.:   |.||::.:.||:||||| .:..|:.||:   .||..
Mouse   107 RIVGGEDSMDAQWPWIVSILKNGSHH---CAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWK 168

  Fly   101 YNEPAFR-HTVSSENFIRYPHY---VGLDHDLALIKTPH-VDFYSLVNKIELPSLDDRYNSYENN 160
            ...|..| ..|.....:.:|.|   .|...|:||::..| :.|...:..|.||....|.....:.
Mouse   169 LGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDC 233

  Fly   161 WVQAAGWGAIYDGSNV--VEDLRVVDLKVISVAECQAYY----GTDTASENTICVETPDG-KATC 218
            |:  ||||:|.||..:  .:.|:.:.:.:|....|::.|    |.:..:|..:|....:| :..|
Mouse   234 WI--AGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDAC 296

  Fly   219 QGDSGGPLVTKEGDK--LIGITSFVSAYGC-QVGGPAGFTRVTKYLEWIK 265
            .|||||||:.:..|.  |.||.|:  ..|| :...|..:|.:..:..|::
Mouse   297 LGDSGGPLMCQVDDHWLLTGIISW--GEGCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/242 (29%)
Tryp_SPc 41..266 CDD:238113 71/244 (29%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.