DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and ctrb.2

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:270 Identity:74/270 - (27%)
Similarity:124/270 - (45%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEG--RITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            ||.||.:|......||  .:.|        .|.|  ||.||..|.....|:  .|||..:..:.:
Zfish     7 LLCLALIGTAYGCGVP--AIPP--------VITGYARIVNGEEAVPHSWPW--QVSLQDSTGFHF 59

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHY--VGLDHDLALI 131
            ||||:|...||:|||||........:.......:......|::.....::|::  ..:::|:.||
Zfish    60 CGGSLINEWWVVTAAHCNVRTSHRVILGEHDRSSNAESIQTMTVGKVFKHPNFNMFTINNDILLI 124

  Fly   132 K--TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAI-YDGSNVVEDLRVVDLKVISVAEC 193
            |  || ....:.|:.:.|...:|.:..  ......:|||.. ::..:....|:...|.:::..:|
Zfish   125 KLATP-AKINTHVSPVCLAETNDNFPG--GMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDC 186

  Fly   194 QAYYGTDTASENTICVETPDGKATCQGDSGGPLV-TKEGD-KLIGITSFVSAYGCQVGGPAGFTR 256
            :.::| :..::..:|... .|.::|.|||||||| .|:|. .|:||.|:.|:. |....|..:.|
Zfish   187 KRFWG-NKITDLMVCAGA-SGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSV-CSPSSPGVYAR 248

  Fly   257 VTKYLEWIKE 266
            |||...|:.:
Zfish   249 VTKLRAWVDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 63/230 (27%)
Tryp_SPc 41..266 CDD:238113 63/231 (27%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 63/230 (27%)
Tryp_SPc 34..259 CDD:238113 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.