DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG18754

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:217 Identity:57/217 - (26%)
Similarity:89/217 - (41%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WVLTAAHCTAGA--DEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLD--------------- 125
            :|||||||..|.  .:..|...:|...| :....::||:  |.||   ||               
  Fly   134 YVLTAAHCVIGGYLTQNDLVLKSVRLGE-STTDCITSES--RCPH---LDVEVGQTTVHQGFTSS 192

  Fly   126 -----HDLALIKTPHVDFYSLVNKIE-LPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVD 184
                 :|:||::......|:  .||: :..||..:...:.| :|.:||    |.:...:.|....
  Fly   193 GGTYRNDIALLRLQFPVRYT--KKIQPICLLDAEFPLQDLN-LQISGW----DPTKSSQTLITST 250

  Fly   185 LKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK------LIGITSFVSA 243
            :|..:.|:|...| ....|.:.:|........||.|.||.|::...|..      |.||.|:...
  Fly   251 VKERNPADCLNRY-PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQ 314

  Fly   244 YGCQVGGPAGFTRVTKYLEWIK 265
            |....|.|..:|::..:.||||
  Fly   315 YCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 54/214 (25%)
Tryp_SPc 41..266 CDD:238113 57/217 (26%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 57/217 (26%)
Tryp_SPc 108..335 CDD:214473 54/214 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.