DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and PRSS8

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:277 Identity:84/277 - (30%)
Similarity:124/277 - (44%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IRHG-GIEG-----------RITNGNLASEGQVPYIV-----GVSLNSNGNWWWCGGSIIGHTWV 79
            :|.| |.||           |||.|:.|..||.|:.|     ||.:        ||||::...||
Human    24 LRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHV--------CGGSLVSEQWV 80

  Fly    80 LTAAHCTAGADEASLY---YGA---VNYNEPAFRHTVSSENFIRYPHYV--GLDHDLALIKTPH- 135
            |:||||.........|   .||   .:|:|.|...|:  ::.|.:|.|:  |...|:||::... 
Human    81 LSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTL--KDIIPHPSYLQEGSQGDIALLQLSRP 143

  Fly   136 VDFYSLVNKIELPSLDDRYNSYENN-WVQAAGWGAIYDGSNVV--EDLRVVDLKVISVAECQAYY 197
            :.|...:..|.||:.:   .|:.|. .....|||.:....:::  :.|:.:::.:||...|...|
Human   144 ITFSRYIRPICLPAAN---ASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLY 205

  Fly   198 GTDT-------ASENTIC---VETPDGKATCQGDSGGPL-VTKEG-DKLIGITSFVSAYGCQVGG 250
            ..|.       ..|:.:|   ||  .||..||||||||| ...|| ..|.||.|:..|.|.: ..
Human   206 NIDAKPEEPHFVQEDMVCAGYVE--GGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGAR-NR 267

  Fly   251 PAGFTRVTKYLEWIKEE 267
            |..:|..:.|..||:.:
Human   268 PGVYTLASSYASWIQSK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 77/252 (31%)
Tryp_SPc 41..266 CDD:238113 78/253 (31%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 77/252 (31%)
Tryp_SPc 45..284 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.