DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and ctrb.3

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:279 Identity:80/279 - (28%)
Similarity:128/279 - (45%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGLTLLS-LAFLGVCSALTVPHSLVHPRDLEIRHGGIEG--RITNGNLASEGQVPYIVGVSLNS 62
            |..|.||| :||........||  .:.|        .:.|  ||.||..|.....|:  .|||..
Zfish     1 MAFLWLLSCVAFFSAAYGCGVP--AIPP--------VVSGYARIVNGEEAVPHSWPW--QVSLQD 53

  Fly    63 NGNWWWCGGSIIGHTWVLTAAHCTAGADEASLY----YGAVNYNEPAFRHTVSSENFIRYPHYVG 123
            ...:.:||||:|...||:|||||:.......:.    .|..|..|..  .|:.......:|.|..
Zfish    54 FTGFHFCGGSLINEFWVVTAAHCSVRTSHRVILGEHNKGKSNTQEDI--QTMKVSKVFTHPQYNS 116

  Fly   124 --LDHDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAI-YDGSNVVEDLRVVD 184
              :::|:||:| |......:.|:.:.|....|.:.|  ......:|||.. |:.....::|:.|.
Zfish   117 NTIENDIALVKLTAPASLNAHVSPVCLAEASDNFAS--GMTCVTSGWGVTRYNALFTPDELQQVA 179

  Fly   185 LKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGD--KLIGITSFVSAYGCQ 247
            |.::|..:|:.::|:: ..:..||.... |.::|.||||||||.::.:  .|:||.|:.|: .|.
Zfish   180 LPLLSNEDCKNHWGSN-IRDTMICAGAA-GASSCMGDSGGPLVCQKDNIWTLVGIVSWGSS-RCD 241

  Fly   248 VGGPAGFTRVTKYLEWIKE 266
            ...|..:.|||:..:|:.:
Zfish   242 PTMPGVYGRVTELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/233 (29%)
Tryp_SPc 41..266 CDD:238113 68/234 (29%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 68/233 (29%)
Tryp_SPc 34..261 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.