DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and ctrl

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:240 Identity:72/240 - (30%)
Similarity:110/240 - (45%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104
            ||.||..|..|..|:  .|||..:..:.:||||:|...||:|||||...|....:..|..:....
Zfish    31 RIVNGENAVSGSWPW--QVSLQQSNGFHFCGGSLINQYWVVTAAHCRVQAGYHYVILGEHDRGSS 93

  Fly   105 AFRHTVSS-ENFIRYPHY--VGLDHDLALIK-------TPHVDFYSL-VNKIELPSLDDRYNSYE 158
            |....|.| ...|.:|:|  ...::|:.|:|       |..:....| .:...:||         
Zfish    94 AESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPAQLTSRISPVCLAASSTSIPS--------- 149

  Fly   159 NNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSG 223
            .......|||.....|: ...|:...|.::|.|:|:.|:|.:..::..||... .|.::||||||
Zfish   150 GTRCVTTGWGKTGSTSS-PRILQQTALPLLSPAQCKQYWGQNRITDAMICAGA-SGVSSCQGDSG 212

  Fly   224 GPLVTKEGDK--LIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKE 266
            ||||.:....  .:||.|:.:: .|.|..||.:.||:...:||.:
Zfish   213 GPLVCESSGAWYQVGIVSWGTS-DCNVRTPAVYARVSYLRQWIDQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/236 (30%)
Tryp_SPc 41..266 CDD:238113 71/237 (30%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 70/236 (30%)
Tryp_SPc 32..257 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.