DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and cela1.6

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:271 Identity:77/271 - (28%)
Similarity:127/271 - (46%) Gaps:22/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWW-WC 69
            :|.:..|.|.:||    :|..||.||.:..  :.|:..|.:|.....|:.:.:...|.|::: .|
Zfish     1 MLRILLLSVLAAL----ALAEPRYLEEQIA--QERVVGGEVARPNSWPWQISLQYLSGGSYYHTC 59

  Fly    70 GGSIIGHTWVLTAAHCTAGADEASLYYGAVN-YNEPAFRHTVSSENFIRYPHY----VGLDHDLA 129
            ||::|...:|||||||...:....:..|..: |.:......::..|...:|::    |...:|:|
Zfish    60 GGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQEGREQYMTVSNVYIHPNWNRNNVAAGYDIA 124

  Fly   130 LIKTPHVDFYSLVNKIELPSLDDRYNSY-ENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAEC 193
            |::..  ...||...::|.:|....... .||.....|||....|.::...|:...|.|:....|
Zfish   125 LLRLS--SNASLNTYVQLGTLPPSGQVLPHNNACYITGWGLTSTGGSLSAQLKQAYLPVVDYNTC 187

  Fly   194 QA--YYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLI--GITSFVSAYGCQV-GGPAG 253
            ..  ::|:..  :||:........:.|||||||||..:...:.:  |:|||||:.||.. ..|..
Zfish   188 SRGDWWGSTV--KNTMVCAGGGSLSGCQGDSGGPLNCQVSGQYVVHGVTSFVSSSGCNAYQKPTV 250

  Fly   254 FTRVTKYLEWI 264
            ||||:.|:.||
Zfish   251 FTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 65/235 (28%)
Tryp_SPc 41..266 CDD:238113 66/236 (28%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.