DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG11841

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:259 Identity:72/259 - (27%)
Similarity:110/259 - (42%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITNGNLASEGQVPYI--VGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVN--- 100
            |.:|..|...:.|:.  :|....:|...|:|||::|.:..|||||||....      :|.||   
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSE------HGEVNVVR 130

  Fly   101 YNEPAF-RHTVSSENFIRYPHYVGLDHDLALIKTPHVDFYSLVNKIELPSLDD--RYNSYEN--- 159
            ..|..| ..|..:|     |...|:   |||...|..:...|.|.|.:..||.  ::|.|::   
  Fly   131 LGELEFDTDTDDAE-----PEDFGV---LALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPAC 187

  Fly   160 ----------NWVQAAGWGAIYDGSNVVEDLRVVDL-----KVISVAECQAYYGTDTASENTICV 209
                      ::: |.|||.........:.|..|.|     :.:|..:...........::.:|:
  Fly   188 LPFDDGEQHESFI-AIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCI 251

  Fly   210 ETPDGKATCQGDSGGPLVTKEGD-----KLIGITSFVSAYGCQVGG-PAGFTRVTKYLEWIKEE 267
            .:.|.|.||.||||||::....|     .::||||  :...|.... |:.:|||..:|.|||.|
  Fly   252 GSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSAYTRVHYFLNWIKGE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/254 (27%)
Tryp_SPc 41..266 CDD:238113 70/256 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 69/255 (27%)
Tryp_SPc 72..310 CDD:214473 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.