DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG4815

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:261 Identity:65/261 - (24%)
Similarity:100/261 - (38%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGIEGRITNG---NLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHC----------T 86
            |....||.||   .:.|.|.    ||:.| .||....|..:::....:||||||          .
  Fly    29 GRFHPRIYNGIKTTVESLGG----VGIQL-FNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHV 88

  Fly    87 AGADEASLYYGAVNYNEPAFRHTVSSENFIR---YPHYVGLDH--DLALIKTPHVDFYSLVNKIE 146
            .|...|...:...|:|:         ...||   :|.|..:..  |:|:.||.:           
  Fly    89 IGGKSAEFTWHGNNFNK---------NKLIRVQIHPKYAKMKFIADVAVAKTKY----------- 133

  Fly   147 LPSLDDRYNSY---------ENNWVQAAGW---GAIYDGSNVVEDLRVVDLKVISVAECQAYYGT 199
              .|..:|..|         ..:.:.||||   |.::|.|. .:..|.:.:.::|..:|:.....
  Fly   134 --PLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESR-KKTFRSMKVGIVSKRDCEKQLDR 195

  Fly   200 DTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264
             ....|.||....:.|..|.|||||||:.  |.::.||.::....| ....|..:..|..|.::|
  Fly   196 -KMPPNIICAGAYNNKTLCFGDSGGPLLL--GRQVCGINTWTFKCG-NNEKPDVYMGVRYYAKFI 256

  Fly   265 K 265
            |
  Fly   257 K 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 62/253 (25%)
Tryp_SPc 41..266 CDD:238113 63/255 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 58/237 (24%)
Trypsin 49..256 CDD:278516 56/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.