DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG31199

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:298 Identity:60/298 - (20%)
Similarity:97/298 - (32%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGVCSALTVPHSLVHPRDLEIRHG-GIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIG 75
            |.:.|...:|..  |.....|.:| |.||:|                   ..||    |.|.::.
  Fly    38 LNMQSTFAIPTE--HQWVARIVYGKGFEGKI-------------------RDNG----CLGVLVS 77

  Fly    76 HTWVLTAAHCTA---GADEA-SLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIKT--- 133
            ...||..|||..   |..|| |::.|..|.:.|.......::.:...|     ..::.|.:.   
  Fly    78 KRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRP-----SQEIKLAEIAIH 137

  Fly   134 PHVDFYSLVNKIELPSLDDRYNSYEN-------------------NWVQAAGWGAIYDGSNVVED 179
            |..|..:|.|.:.:.:|......|.|                   .:|.|        |..|.||
  Fly   138 PDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVA--------GLRVFED 194

  Fly   180 LRVVD-LKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIG------I 237
            .|:.. :..:|...||:...|...|.||:|           |....|:....|..|:|      :
  Fly   195 FRLKTWVNTLSRGFCQSKVKTLVTSSNTVC-----------GYHKQPVAYYLGAPLVGLQKKGHV 248

  Fly   238 TSFVSAYGCQVGG-------PAGFTRVTKYLEWIKEET 268
            |......|..:..       .:.|..:..|:::|::.:
  Fly   249 TQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 50/263 (19%)
Tryp_SPc 41..266 CDD:238113 51/264 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 54/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.