DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG17477

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:106/250 - (42%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGNLASEGQVPYIVGVS--LNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYY--G 97
            :|..|..|..|:||..||.|.:.  |.|:    .|||:||...|::||.||..|...:.|..  |
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQTLLGSH----LCGGAIISDRWIITAGHCVKGYPTSRLQVATG 83

  Fly    98 AVNYNEPAFRHTVSSENFIRYPHYVGL---------DHDLALIK-TPHVDFYSLVNKIELPSLDD 152
            .:.|.||         ..:.||..:.|         .:|:.|:. ...:.|.:|...:|||:...
  Fly    84 TIRYAEP---------GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPF 139

  Fly   153 RYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENT------ICVET 211
            ...:.|   :...|||:.....::...|:.|..:.::...|::..   :|.|:.      ||...
  Fly   140 PRGASE---LVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMM---SAYEDLELGPCHICAYR 198

  Fly   212 PDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKE 266
            ......|.||||||||.:  ..|:||.:|.  ..|..|.|..|..:..|.:|:::
  Fly   199 QANIGACHGDSGGPLVHQ--GTLVGILNFF--VPCAQGVPDIFMNIMYYRDWMRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 65/243 (27%)
Tryp_SPc 41..266 CDD:238113 66/244 (27%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/245 (27%)
Tryp_SPc 27..246 CDD:214473 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.