DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG3505

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:293 Identity:78/293 - (26%)
Similarity:124/293 - (42%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNW---WWC 69
            |.|.||   |||  |.|: |.|.    |.:..:.:|.......:.|::..:.. :.||.   ..|
  Fly    84 STAGLG---ALT--HPLL-PSDC----GKVRWQRSNDTDTRIREFPWLALIEY-TRGNQEKIHAC 137

  Fly    70 GGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNE---------------------PAFRHTVSSE 113
            ||.:|...:|||||||.|.|..::|...||...|                     |.:: .::.|
  Fly   138 GGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQ-DIAIE 201

  Fly   114 NFIRYPHYVGLD----HDLALIK--TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYD 172
            ..:.:|.|...|    :|:||::  :| ......|..|.||:...|.:..|:...:.|||.|   
  Fly   202 ELLPHPLYNRTDRTQINDIALVRLASP-AKLNDFVQPICLPNKQLRADELEDLVTEVAGWQA--- 262

  Fly   173 GSNVVEDLRVVDLKVISVAECQAYYGTD--TASENTICVETPDGKATCQGDSGGPLV--TKEGDK 233
              :..:.:|...:.:.|:.|||..|.:.  ....:.:|..|  ....|.|::||||:  ..:|..
  Fly   263 --SSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLT--NSQECYGNAGGPLMLFKNDGYL 323

  Fly   234 LIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKE 266
            |.|:.||..........|..:|||..|::||.:
  Fly   324 LGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 64/257 (25%)
Tryp_SPc 41..266 CDD:238113 66/258 (26%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/254 (26%)
Tryp_SPc 111..354 CDD:214473 63/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.