DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG9649

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:114/282 - (40%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GIEGR--------ITNGNLASEGQVPYI------VGVSLNSNGNWWWCGGSIIGHTWVLTAAHCT 86
            ||.||        |.||.....||:|::      ||...|     :.|||::|....|::|||| 
  Fly   244 GICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYN-----FLCGGTLISARTVISAAHC- 302

  Fly    87 AGADEASLYYGAVNYNEPAFRHTVS-SENFI------------------RYPHYVGLDHDLALIK 132
                   ..:|:.|.  |..|..|| ..|.:                  :|...|..|.||||::
  Fly   303 -------FRFGSRNL--PGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQ 358

  Fly   133 -TPHVDFYSLVNKI---------ELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKV 187
             :.|||....:..|         ||||   .:.||      .||||....|:......::.|..:
  Fly   359 LSNHVDIGDYIKPICLWNENFLLELPS---GHKSY------VAGWGEDEKGNRNTRLAKMTDTDI 414

  Fly   188 ISVAECQAYYGTDTA---SENTICVETPDGKATCQGDSGGPLVTKEGD--KLIGITSFVSA---- 243
            |:..||:.....:.|   :.:|||.........|.|||||.|:.:|.|  .|.|:   |||    
  Fly   415 ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGV---VSAGQRM 476

  Fly   244 -YGCQVGGPAGFTRVTKYLEWI 264
             ..|.:..|..:|.|.|::||:
  Fly   477 TNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 76/276 (28%)
Tryp_SPc 41..266 CDD:238113 76/269 (28%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 75/267 (28%)
Tryp_SPc 259..497 CDD:214473 73/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.