DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG14088

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:259 Identity:60/259 - (23%)
Similarity:94/259 - (36%) Gaps:76/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GNLASE---GQVPYIVGVSLNSNGNWWWCG-----------GSIIGHTWVLTAAHC--TAGADEA 92
            ||:..|   |..|.|||.         |..           |::|...::||..||  :.|...|
  Fly    28 GNICGERRDGLSPDIVGP---------WTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRA 83

  Fly    93 SL-YYGAVNYNEPAFRHTV----SSENF--IRYPHYVGLDHDLALIKT----PHVDFYSLVNKIE 146
            .| .||.:. :|.|..|.|    |:.||  ....:.:||   :.|::|    .|:          
  Fly    84 RLGEYGRIG-SELAEDHIVAAFFSNANFNPETQANNMGL---MKLLRTVVYKEHI---------- 134

  Fly   147 LP---SLDDRYNSY--ENNWVQAAGWGAIYDGSNVVEDLRVVDL-----KVISVAECQAYYGTDT 201
            :|   .:|.|..::  |.::.....| ...|.|.::....|:.:     |:.....|..:...|:
  Fly   135 IPVCILMDSRMQTFADELDYFNGTTW-KNSDKSPMLRSKTVIRMPQACGKLDHGQFCAGHKDLDS 198

  Fly   202 ASENTICVETPDGKA-TCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264
            ..|       |.|.| |.:.|..||..|    .|.||.:.|..   :......:|.|.:..:||
  Fly   199 CDE-------PSGAALTREIDYIGPNRT----VLFGIANSVEV---KCSNSRTYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 58/257 (23%)
Tryp_SPc 41..266 CDD:238113 60/259 (23%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/245 (22%)
Tryp_SPc 42..248 CDD:214473 53/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.