DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG18223

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:102/241 - (42%) Gaps:56/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VSLNSN------GNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYG-------AVNYNEPAFRHT 109
            ||:.|.      |:..:|||.||..|::||:|||  ..|:..:.:.       |...|....|..
  Fly    62 VSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHC--AMDKRKIVHRSRVLVVVAGTTNRLKSRKG 124

  Fly   110 VS-----SENFIRYPHYVGLDHDLALI----KTPHVDFYSLVNKIELPSLDDRYN-SYENNWVQA 164
            :|     .:.|:.....|...:::||:    |.| :| ..||..|.||:.|.... :|     ..
  Fly   125 LSLNMEVKKIFVPDKFTVFNTNNIALMMLAKKLP-LD-NPLVGVINLPTADPEPGLNY-----TV 182

  Fly   165 AGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICV--------ETPDGKATCQGD 221
            .|||.|:.|..:..|:..:|::::....|:.  ......|..:|.        |.|     |.||
  Fly   183 LGWGRIFKGGPLASDILHIDVELLPRDICEK--KVHIFKEEMMCAGNLNNTMDENP-----CAGD 240

  Fly   222 SGGPLVTKEGDKLIGITSFVSAYGCQVGG---PAGFTRVTKYLEWI 264
            :|.||:..|  .:.|:.|:  ..||  |.   |:.:|.|..:::||
  Fly   241 TGSPLIFNE--TVFGVVSY--RVGC--GSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 61/239 (26%)
Tryp_SPc 41..266 CDD:238113 63/241 (26%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 63/241 (26%)
Tryp_SPc 60..280 CDD:214473 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.