DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Jon74E

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:254 Identity:99/254 - (38%)
Similarity:134/254 - (52%) Gaps:16/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LEIRHGGIEGRITNGNLASEGQVPYIVGVSLNS-NGNWWWCGGSIIGHTWVLTAAHCTAGADEAS 93
            |::.| ||.|||..|.||...|.||.||:|:.. |..:.|||.|:|...::||||||...|...:
  Fly    22 LDMGH-GIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAIT 85

  Fly    94 LYYGAVNYNEPAFRHTVSSENFIRYPH----YVGLDHDLALIKTPH-VDFYSLVNKIELPSLDDR 153
            .|.|.|....|  |..:.|.|...:.|    ...|::|:||::.|. ......:..|.||.|...
  Fly    86 YYLGGVLRLAP--RQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSS 148

  Fly   154 YNSYENNWVQAAGWGAIYDGSNVVED-LRVVDLKVISVAECQAYYGTDTASENTICVETPDGKAT 217
            .|||:.....|:|||.:.|.|..:.| ||.|...|.|..:|:  |.........||::|..||:|
  Fly   149 RNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE--YSYANIKPTNICMDTTGGKST 211

  Fly   218 CQGDSGGPLV----TKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGIYY 272
            |.||||||||    .:..|.|||:||:....||..|.|:.|||:|.||:||.|.:|::|
  Fly   212 CTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 89/234 (38%)
Tryp_SPc 41..266 CDD:238113 90/235 (38%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.020

Return to query results.
Submit another query.