DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG8329

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:271 Identity:107/271 - (39%)
Similarity:158/271 - (58%) Gaps:19/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRH-GGIEGRITNGNLASEGQVPYIVGVSLNSNGNWW 67
            |.||.|....||:     |   ..|:....| ||.:..|.||..|.||:.||.||:.:|:.... 
  Fly     5 LVLLLLFVATVCA-----H---RNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVG- 60

  Fly    68 WCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYV-GLDHDLALI 131
              |||:||:.||||||||.. .|..:::||:........:|||:..||.|:|.|. ...||:.||
  Fly    61 --GGSVIGNNWVLTAAHCLT-TDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLI 122

  Fly   132 KTPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAY 196
            :||:|.|.:|:||:.||....:...:||.|..|.|||.:.:| .:.:.|:.:|::|||..||...
  Fly   123 RTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANG-GLADWLQCMDVQVISNGECARS 186

  Fly   197 YGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYL 261
            ||:..:::  :|....|||:.|.|||||.|||.:....:|:.:|.| .||: .||:|:|||:.:|
  Fly   187 YGSVASTD--MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFAS-IGCK-SGPSGYTRVSDHL 247

  Fly   262 EWIKEETGIYY 272
            :||:|::||.|
  Fly   248 DWIREKSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 90/224 (40%)
Tryp_SPc 41..266 CDD:238113 92/225 (41%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 92/226 (41%)
Tryp_SPc 35..250 CDD:214473 90/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.