DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Jon66Ci

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:269 Identity:141/269 - (52%)
Similarity:178/269 - (66%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            ||:|:||   |.|| :...|:|||:||. :...||||||||..|.||:.||.||:..:..   ||
  Fly     5 LTILALA---VASA-SAYESVVHPKDLS-KVAKIEGRITNGYPAEEGKAPYTVGLGFSGG---WW 61

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIKT 133
            ||||||.:.|||||.|| .|.|..::|:||.......|.|.|.|.|||.:.     ..|:|||:.
  Fly    62 CGGSIISNEWVLTAEHC-IGGDAVTVYFGATWRTNAQFTHWVGSGNFITHG-----SADIALIRI 120

  Fly   134 PHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYG 198
            |||||:.:|||:||||.:||||.|...|..|.|||..||||.:.:.|:.|||::|..:||.:|||
  Fly   121 PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYG 185

  Fly   199 TDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEW 263
            |.|..:|.|||...|||.||.|||||||||.:|.||:|:|::||..|||.|.||||.|||.:|:|
  Fly   186 TGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDW 250

  Fly   264 IKEETGIYY 272
            |::.|||.|
  Fly   251 IRDHTGIAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 118/223 (53%)
Tryp_SPc 41..266 CDD:238113 119/224 (53%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 118/223 (53%)
Tryp_SPc 37..254 CDD:238113 119/225 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470820
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.