DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG33465

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:281 Identity:65/281 - (23%)
Similarity:107/281 - (38%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSLAFLG--VCSALT-----VPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSN 63
            :||||.:|  :|..|.     ..|......::...||..|            ..|::..:..|  
  Fly     4 VLSLALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATE------------TAPWMASIYKN-- 54

  Fly    64 GNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDH-- 126
             |.:.|.|:::...:|||||.|.:...:..:.:|.  ||:  :|......|..:|...|.|.|  
  Fly    55 -NQFICDGTLVHKLFVLTAASCISKDSQLYVLFGM--YNQ--YRDASQFFNNEQYGVAVALQHSN 114

  Fly   127 --------DLALIKT-PHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLR- 181
                    |:.|::. ..|..|:.:..|.: .||....|......:..||.  ..|:.....:| 
  Fly   115 FRPNNGVNDIGLLRLYGEVTHYAHIRPICI-ILDHVVKSAPFERFEGFGWQ--QQGTEASSQVRQ 176

  Fly   182 VVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVT--KEGDKLIGITSFVSAY 244
            .|.|......||.........:|...|....| ::.|:.:||.||..  ..|.|.|.:...:.:|
  Fly   177 TVYLSQKKPFECHRNGQLLPINEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSY 240

  Fly   245 GCQVGGPAG-FTRVTKYLEWI 264
            |.::..|.. :|.|..:.:||
  Fly   241 GSELCSPTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 52/238 (22%)
Tryp_SPc 41..266 CDD:238113 54/239 (23%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 54/227 (24%)
Tryp_SPc 46..261 CDD:214473 52/225 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.