DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and sphinx2

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:286 Identity:74/286 - (25%)
Similarity:117/286 - (40%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGV--------SL 60
            |.:|||.| .||                 ....:..|||.|..|....:.|:||:        ||
  Fly     7 LLVLSLTF-SVC-----------------EKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSL 53

  Fly    61 NSNGNWWWCGGSIIGHTWVLTA----------AHCTAGADEASLYYGAVNYNEPAFRHTVSSENF 115
            .      :..|:||.:.|:||.          ||  .|:..|...|..:.         :..|||
  Fly    54 K------FGAGTIISNQWILTVKEVLIFKYIEAH--FGSKRAFWGYDILR---------IYRENF 101

  Fly   116 IRYPHYVGLDHDLALIKTPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDL 180
              |.|| .....:||:|.|:..|...::::.:|:...|:..|..|.....|||.......:...:
  Fly   102 --YFHY-DKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWM 163

  Fly   181 RVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTK-EGDKLIGITSFVSAY 244
            |.|:::|::..||..|:......|  :|......|..|:||.||.:||. .....|||. ::...
  Fly   164 RCVEVEVMNNTECAKYHTPLKWYE--MCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPT 225

  Fly   245 GCQVGGPAGFTRVTKYLEWIKEETGI 270
            .|.:|.|:...||:.:::|||..:|:
  Fly   226 NCSIGYPSVHIRVSDHIKWIKHVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 63/242 (26%)
Tryp_SPc 41..266 CDD:238113 64/243 (26%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 63/242 (26%)
Tryp_SPc 26..248 CDD:304450 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.