DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Jon65Ai

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:127/269 - (47%)
Similarity:173/269 - (64%) Gaps:7/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            :.:|::..|||.::.|.....|..:|:.:....||||||.|..|.||:||||||:..:.||...|
  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW 65

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIKT 133
            |||||||:|||:||.|||.|.:..::||||:...:..:.|.|...:||.  |..|   |::||:|
  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIE--HGSG---DISLIRT 125

  Fly   134 PHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYG 198
            |||||:|||||:|||..|||||:|:..|...:|||...|...|.|.|..||:::...:.|:.|||
  Fly   126 PHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYG 190

  Fly   199 TDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEW 263
              :.|.:.||:.||:.|.||.||||||||..:|::.:||.||.|:.||...||.|..|||.||:|
  Fly   191 --SFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDW 253

  Fly   264 IKEETGIYY 272
            |::.|||.|
  Fly   254 IRDNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 111/223 (50%)
Tryp_SPc 41..266 CDD:238113 112/224 (50%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 111/223 (50%)
Tryp_SPc 41..257 CDD:238113 110/222 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470810
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1111.010

Return to query results.
Submit another query.