DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG6462

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:245 Identity:91/245 - (37%)
Similarity:129/245 - (52%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGNLASEGQVPYIVGVSLNSNG-NWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGA-- 98
            :..||..|.||:.|..||.||:.:..:| :...||||:|...:|||||||...|..|.:|.||  
  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV 137

  Fly    99 -VNYNEPAFRHTVSSENFIRYPHYVGLD--HDLALIKTPH-VDFYSLVNKIELPSLDDRYNSYEN 159
             .:..:......|:..:||.||.|:|..  .|||||:.|. |.....|..|||.......|....
  Fly   138 FADVEDSVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVG 202

  Fly   160 NWVQAAGWGAIYDGSNV-VEDLRVVDLKVISVAECQAYYGTDTASENT-ICVETPDGKATCQGDS 222
            ..|..:|||.:.|.::. ...|:.:|.:||....|..|:.....|:.. :|.:..:|:..|.|||
  Fly   203 KVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGACNGDS 267

  Fly   223 GGPLV--TKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGI 270
            |||:|  .:....|||:|||.||.||:||||..:||:|.||.||:::|.:
  Fly   268 GGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 88/234 (38%)
Tryp_SPc 41..266 CDD:238113 89/235 (38%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 88/234 (38%)
Tryp_SPc 77..314 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.930

Return to query results.
Submit another query.