DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG10477

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:275 Identity:124/275 - (45%)
Similarity:170/275 - (61%) Gaps:6/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGLTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGN 65
            |:...:|.||...|.:.:....:.||||| ......|:|||||||.|:..|.||.||:|..|:..
  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRD-SSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAG 64

  Fly    66 WWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHY--VGLDHDL 128
            .||||||||.:||||||||||.||...::|||:........:..|||..|:::..|  ..|.:|:
  Fly    65 SWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDI 129

  Fly   129 ALIKTPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGS-NVVEDLRVVDLKVISVAE 192
            :|||||.|.|...:|||.||::...|::|......|:|||...|.| .|..:|:....:||:.|.
  Fly   130 SLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAV 194

  Fly   193 CQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRV 257
            ||..:|:...:...||||:.:.|:||||||||||..  .::|||:|||||:.||:...|||||||
  Fly   195 CQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL--NNRLIGVTSFVSSKGCEKNAPAGFTRV 257

  Fly   258 TKYLEWIKEETGIYY 272
            |.||:|||.::|::|
  Fly   258 TSYLDWIKNQSGVFY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 107/226 (47%)
Tryp_SPc 41..266 CDD:238113 108/227 (48%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 107/226 (47%)
Tryp_SPc 40..267 CDD:238113 109/228 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470858
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.