DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG15873

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:115/281 - (40%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTVPHSLVHPRDLEIRHGGIEGRITNGN---LASEGQVP-------YIVGVS----LNSNGNWWW 68
            |||...|:....|.....|:.|.|::..   |.|.|..|       ::|.:.    :...|:..:
  Fly     4 LTVFLGLILSTSLSDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHF 68

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASL-------YYGAVN----YNEPAFRHTVSSENFIRYPHYV 122
            |.|.::....|||||||.....:||:       .:|.:.    |:|..||   |.:..:.:|.|.
  Fly    69 CSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFR---SVDRLVVHPEYE 130

  Fly   123 GL-DHDLALIKTPHVDFYSLVNKIE------LPSLDDRYN--SYENNWVQAAGWGAIYDGSNVVE 178
            .. .:|||:::        |..:::      ||.|..:..  :|.:..: ..|||.||.......
  Fly   131 RYKKNDLAILR--------LSERVQSSNHDVLPLLMRKTANVTYGDTCI-TLGWGQIYQHGPYSN 186

  Fly   179 DLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSA 243
            :|..:|:.:...:.||.:|.|.||..| :|.|.......|.||.||||:.|  ..|.|:..  ..
  Fly   187 ELVYLDVILRPPSLCQKHYDTFTADHN-VCTEPVGESMNCAGDMGGPLLCK--GALFGLIG--GH 246

  Fly   244 YGCQVGGPAGFTRVTKYLEWI 264
            .||..|....|.....|.:||
  Fly   247 MGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 65/257 (25%)
Tryp_SPc 41..266 CDD:238113 67/258 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 59/230 (26%)
Tryp_SPc 59..250 CDD:238113 55/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.