DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG30283

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:242 Identity:69/242 - (28%)
Similarity:112/242 - (46%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104
            :|..|:.|.....|::..| :...|  :.|||::|.:.:|||:|||.|.. |..:..|.:.....
  Fly    42 KILGGHNAPVASAPWMAMV-MGEGG--FHCGGTLITNRFVLTSAHCIANG-ELKVRLGVLEREAE 102

  Fly   105 AFRHTVSSENFIRYPHYVGLDHDLALIKTPHVDFYS--------LVNKIELPSLDD---RYNSYE 158
            |.:..|.: .|:...:|.. .|||||::......||        |::.: :.::|:   ::.:| 
  Fly   103 AQKFAVDA-MFVHTDYYFD-QHDLALLRLAKRVHYSDNISPICLLLDPL-VKNIDEHIVKFRTY- 163

  Fly   159 NNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSG 223
                   |||.....|: ...|:...|..:..:||...|.....:.|.||.|:.:.. ||.||||
  Fly   164 -------GWGKTESRSS-SRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANAN-TCNGDSG 219

  Fly   224 GPL---VTKEGDKLI---GITSFVSAYGCQVGGPAGFTRVTKYLEWI 264
            |||   ||.:..:::   |:|||..| .|...  ..||.|..:|:||
  Fly   220 GPLTAIVTYDHVQMVFQFGVTSFGHA-DCSKA--TVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 67/240 (28%)
Tryp_SPc 41..266 CDD:238113 69/241 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/240 (28%)
Tryp_SPc 43..266 CDD:238113 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.