DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG10764

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:274 Identity:78/274 - (28%)
Similarity:129/274 - (47%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLLSLAFLGVCSALTVPHSLVHPRDLEIRHG-GIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            :|:|:|.|.:.:.....:.  |.:.||...| ....:|:.|:.|:|   |..:.::...|.:.:.
  Fly     3 SLVSVALLSLLTLCVTENE--HFKFLETPCGISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQ 62

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDH--DLALI 131
            |||:||...:||:||||.....:..:..||.|.||||..|||.  |...:..::..::  |:.|:
  Fly    63 CGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTVI--NVFVHHDFIASEYRNDIGLL 125

  Fly   132 KTPHVDFYSL-VNKIEL---PSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAE 192
            :......|:: |..|.:   |:|.......:.  .:|.|||......:::  |:.:.|..:...|
  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKT--FRALGWGNRNGKLSIM--LQTIYLLHLKRNE 186

  Fly   193 CQAYYGTDTASENTICVETPDGKATCQGDSGGPLVT-------KEGDKLIGITSFVSAYGCQVGG 250
            |:.....:..|.. ||..|.:|. ||:|||||||.|       |..:..:||.||...   :..|
  Fly   187 CKRKLNFNLNSRQ-ICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDP---ECRG 246

  Fly   251 PAGFTRVTKYLEWI 264
            ...:|.||.|::||
  Fly   247 VGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/236 (29%)
Tryp_SPc 41..266 CDD:238113 70/237 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 68/236 (29%)
Tryp_SPc 38..263 CDD:238113 70/237 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.