DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Prss33

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:301 Identity:84/301 - (27%)
Similarity:119/301 - (39%) Gaps:65/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRG---LTLLSLAFLGV----CSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGV 58
            |||   |.:|.|..||.    |:|...|.              :..||..|..|.:|:.|:  ..
Mouse    65 MRGASHLQILLLLVLGTRMQECAACGQPR--------------MSSRIVGGRDAQDGEWPW--QT 113

  Fly    59 SLNSNGNWWWCGGSIIGHTWVLTAAHC---TAGADEASLYYGAVNYN--------EPAFRHTVS- 111
            |:...|. ..||||:|...|||||.||   .....|.|:..||::.:        .|..|..:. 
Mouse   114 SIQHRGA-HVCGGSLIAPQWVLTAGHCFPRRVWPSEYSVLLGALSLDVRSSHELLVPVLRVLLPP 177

  Fly   112 --SENFIRYPHYVGLDHDLALIKTPH-VDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDG 173
              ||:..|        .||||::..| |...:.:..:.||:...........||  .|||::..|
Mouse   178 DYSEDEAR--------GDLALLQLRHPVSLSTRIQPVCLPAPGSHPPPGSPCWV--TGWGSLSPG 232

  Fly   174 SNVVE--DLRVVDLKVISVAECQAYY--------GTDTASENTICVETPDG-KATCQGDSGGPLV 227
            ..:.:  .|:.|.:.::....|...|        |........:|.....| |..|||||||||.
Mouse   233 VPLPKGRPLQGVRVPLLDSRACDRLYHVGANVPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLT 297

  Fly   228 TKEGDK--LIGITSFVSAYGCQV-GGPAGFTRVTKYLEWIK 265
            ..|...  |:|:.|:  ..||.: ..|..:|.|.||..||:
Mouse   298 CMESGHWVLVGVVSW--GKGCALPNRPGVYTNVAKYSPWIQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/252 (28%)
Tryp_SPc 41..266 CDD:238113 72/254 (28%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.