DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG4650

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:260 Identity:62/260 - (23%)
Similarity:104/260 - (40%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGR---ITNGNLASEGQVPYIVGVSLNSNGNWWWC 69
            :|.||     |.||.|..:          ::||   :|||.:|:....|::  ..|:::...:.|
  Fly    10 ALLFL-----LPVPGSSQY----------LDGRCGLLTNGKIANNISSPWM--AYLHTSELLYVC 57

  Fly    70 GGSIIGHTWVLTAAHCTAGADE----ASLYYGAVNYNEPAFRHTVSSENFIRYPH---------- 120
            ||::|....||||||||..:::    ...:.|..:.|:........|:.||...:          
  Fly    58 GGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIA 122

  Fly   121 YVGLDHDLALIKTPH---VDFYSLVNKIELPSLDDRYNSYENN--WVQAAGWGAIYDGSNVVEDL 180
            .:||..|:...||..   :.::::            :..|.:|  .:..|.||...| .|..:..
  Fly   123 ILGLATDIVFSKTIRPICIVWWTI------------WRKYIDNIQVLSGAQWGLPND-RNESDAF 174

  Fly   181 RVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL---VTKEGDK---LIGITS 239
            |:.|::......|....||...| :..|....|.| .|..|...||   :|.:..:   ||||.:
  Fly   175 RITDIRRQPANMCSTLNGTAILS-SQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIAT 237

  Fly   240  239
              Fly   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 54/228 (24%)
Tryp_SPc 41..266 CDD:238113 53/224 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 52/222 (23%)
Tryp_SPc 33..258 CDD:304450 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.