DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG8952

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:283 Identity:96/283 - (33%)
Similarity:144/283 - (50%) Gaps:36/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW--- 68
            |.|..|...|.:..|....:...::     |:.||.:|:.|..||.|:.|.:..::     |   
  Fly     9 LMLVLLAAISVVGQPFDPANSSPIK-----IDNRIVSGSDAKLGQFPWQVILKRDA-----WDDL 63

  Fly    69 -CGGSIIGHTWVLTAAHCTAGADEASLYYGAVN-YNEPAFRHTVSSENFIRYPHYVG-LDHDLAL 130
             ||||||..||||||||||.|.....|.:|.|: :|..|...|  |.|.|.:|.|.. |::|::|
  Fly    64 LCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMT--SNNIIIHPDYNDKLNNDVSL 126

  Fly   131 IKTPH-VDFYSLVNKIEL-----PSLDDRYNSYENNWVQAAGWGAIYDG-SNVVEDLRVVDLKVI 188
            |:.|. :.|.:.:..|:|     .|:|     |..:....||:|...|. .:..|.|....:::|
  Fly   127 IQLPEPLTFSANIQAIQLVGQYGDSID-----YVGSVATIAGFGYTEDEYLDYSETLLYAQVEII 186

  Fly   189 SVAECQAYYGTDTASENTICVETPDGK--ATCQGDSGGPLV----TKEGDKLIGITSFVSAYGCQ 247
            ..|:|.|.||.....::|:|.:..||.  :||.|||||||:    |.:..:.|||.|||:...|.
  Fly   187 DNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCT 251

  Fly   248 VGGPAGFTRVTKYLEWIKEETGI 270
            ...|:|:.||:.:|.:|.::|||
  Fly   252 YRLPSGYARVSSFLGFIADKTGI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 86/242 (36%)
Tryp_SPc 41..266 CDD:238113 86/243 (35%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 86/242 (36%)
Tryp_SPc 38..271 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471048
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.