DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and ctrb.1

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:284 Identity:83/284 - (29%)
Similarity:131/284 - (46%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGLTLLS-LAFLGVCSALTVPHSLVHPRDLEIRHGGIEG--RITNGNLASEGQVPYIVGVSLNS 62
            |..|.:|| |||.|......:|  .:.|        .:.|  ||.||..|.....|:  .|||..
Zfish     1 MAFLWILSCLAFFGAAYGCGIP--AIPP--------VVTGYARIVNGEEARPHSWPW--QVSLQD 53

  Fly    63 NGNWWWCGGSIIGHTWVLTAAHCTA--------GADEASLYYGAVNYNEPAFRHTVSSENFIRYP 119
            :..:.:||||:|...||:|||||..        |..:.|....|:        .|::....|::|
Zfish    54 STGFHFCGGSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAEAI--------QTIAVGKSIKHP 110

  Fly   120 HY--VGLDHDLALIK--TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAI-YDGSNVVED 179
            :|  ..:::|:.|||  || ....:.|:.:.|...:|.:..  ......:|||.. |:..:....
Zfish   111 NYNSFTINNDILLIKLATP-AKINTHVSPVCLAETNDNFPG--GMKCVTSGWGLTRYNAPDTPAL 172

  Fly   180 LRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGD--KLIGITSFVS 242
            |:...|.:::..:|:.|:||: .::..||... .|.::|.||||||||.:...  .|:||.|:.|
Zfish   173 LQQAALPLLTNDDCKRYWGTN-ITDLMICAGA-SGVSSCMGDSGGPLVCENNRVWTLVGIVSWGS 235

  Fly   243 AYGCQVGGPAGFTRVTKYLEWIKE 266
            : .|....||.:.||||...|:.:
Zfish   236 S-TCSTSTPAVYARVTKLRAWVDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/238 (30%)
Tryp_SPc 41..266 CDD:238113 71/239 (30%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 71/238 (30%)
Tryp_SPc 34..259 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.