DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG31269

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:124/282 - (43%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGLTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEG------RITNGNLASEGQVPYIVGVS 59
            |..:.||.|..|....::|.         :.|:....:|      ||..|..|.:|..||  .:|
  Fly     1 MSAVVLLILLGLSGLVSITA---------IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPY--QIS 54

  Fly    60 LNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYY--GAVNYNEPAFRHTVSSENFIRYPH-Y 121
            |........|||:||..|:|||||||...|....|..  |...||:|..|:      |::..| :
  Fly    55 LQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRY------FLKAIHIH 113

  Fly   122 VGLD-----HDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGA-IYDGSNVVED 179
            ...|     :|:||:: ...:.:......|.||.:.    ....:.|...|||: :..|::.: |
  Fly   114 CNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP----MQPGDEVILTGWGSTVLWGTSPI-D 173

  Fly   180 LRVVDLKVISVAECQAYYGTDTASE-NTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSA 243
            |:|:.|:.:...||:|....|...: ..||..:..|:..|.||||||||:  ...|:|:.::  .
  Fly   174 LQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--NGYLVGLVNW--G 234

  Fly   244 YGCQVGGPAGFTRVTKYLEWIK 265
            :.|..|.|.....|..|.:||:
  Fly   235 WPCATGVPDVHASVYFYRDWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/234 (30%)
Tryp_SPc 41..266 CDD:238113 71/236 (30%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/234 (30%)
Tryp_SPc 38..258 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.