DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and sphinx1

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:114/247 - (46%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGV--------SLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYY 96
            ||..|..|....:.|:||:        |||      :..|:||.:.|:||.        :..|.|
  Fly    25 RIAGGYRAKTFTIIYLVGIVYFKSQTSSLN------YGAGTIISNQWILTV--------KTVLKY 75

  Fly    97 GAVNYNEPAFRH-------TVSSENFIRYPHYVGLDHDLALIKTPHVDFYSLVNKIELPSLDDRY 154
            ..:..:..:.|.       .:..||| |: ||.. ||.:||:|.|:..|...::::.:|:.|.|:
  Fly    76 SYIEVHLASRRSYRGFDIIRIYKENF-RF-HYDN-DHVIALVKCPYQKFDRRMDRVRVPAYDTRF 137

  Fly   155 NSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQ 219
            ..|..|.....|:|.....:.:.|.:|.::::|::..||..||......|  :|......|..|:
  Fly   138 ERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYE--MCTSGEGFKGVCE 200

  Fly   220 GDSGGPLVTK-EGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGI 270
            ||.||.:||. .....|||. ::....|.:|.|:...||:.:::|||..:|:
  Fly   201 GDIGGAVVTMGPNPTFIGII-WLMPENCSIGYPSVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 64/239 (27%)
Tryp_SPc 41..266 CDD:238113 65/240 (27%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 64/239 (27%)
Tryp_SPc 26..248 CDD:304450 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.