DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and spirit

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:240 Identity:70/240 - (29%)
Similarity:113/240 - (47%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QVPYIVGVSLNSNGN---WWWCGGSIIGHTWVLTAAHCT-----------AGADEASLYYGAVNY 101
            :.|::..:...||.:   ::.|||::|.:.:|||||||.           .|.|..:|..|    
  Fly   142 EFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG---- 202

  Fly   102 NEPAFRHTVSSENFIRYPHYVGLD--HDLALIKTPHVDFYSLVNKIEL-PSLDDRYNSYENNWVQ 163
                  ..:|....|.:|.|....  :|:||::      .....|.|| |:.........|..|.
  Fly   203 ------EDISIRRVIIHPDYSASTAYNDIALLE------LETAAKPELKPTCIWTQKEVTNTLVT 255

  Fly   164 AAGWG-AIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDG-----KATCQGDS 222
            |.|:| ..:.|.:..:.|: |.||.:|..|||.:|..|..::..:..:...|     :.||||||
  Fly   256 AIGYGQTSFAGLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDS 319

  Fly   223 GGPLVTKEG--DKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265
            ||||:.::|  ..::||||.  ..||..|.|:.:|||:.:::||:
  Fly   320 GGPLLMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWIE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/237 (29%)
Tryp_SPc 41..266 CDD:238113 70/240 (29%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 70/240 (29%)
Tryp_SPc 132..361 CDD:214473 68/237 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.