DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Mcpt2

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:239 Identity:71/239 - (29%)
Similarity:110/239 - (46%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGIEGRITNGNLASEGQVPYIVGVSL-NSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGA 98
            ||:|. |.:..       ||:..:.: ...|....|||.:|...:|||||||.  ..|.::..||
  Rat    23 GGVES-IPHSR-------PYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHCK--GREITVILGA 77

  Fly    99 VNYNE-PAFRHTVSSENFIRYPHYVGLD--HDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYEN 159
            .:..: .:.:..:..|..|.:..|..:.  ||:.|:| ...|:....||.:.|||..|..:....
  Rat    78 HDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLPSPSDFIHPGAM 142

  Fly   160 NWVQAAGWG--AIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDG-KATCQGD 221
            .|  |||||  .:.|.::..  ||.|:|:::....|..|...:...:  :||.:|.. :|...||
  Rat   143 CW--AAGWGKTGVRDPTSYT--LREVELRIMDEKACVDYRYYEYKFQ--VCVGSPTTLRAAFMGD 201

  Fly   222 SGGPLVTKEGDKLIGITSFVSAYG-CQVGGPAGFTRVTKYLEWI 264
            |||||:      ..|:...:.:|| .....||.||||:.|:.||
  Rat   202 SGGPLL------CAGVAHGIVSYGHPDAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 66/232 (28%)
Tryp_SPc 41..266 CDD:238113 68/233 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 69/237 (29%)
Tryp_SPc 21..242 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.