DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG18420

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:103/245 - (42%) Gaps:40/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104
            ||.||.:|.....|::  ..|:::.|.:.|||::|....|||||||........:..|..|....
  Fly    42 RIVNGKVAVRNSSPWM--AFLHTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLK 104

  Fly   105 AFRHTVSSENFIRYPHYVGLDH--DLALIK-TPHVDFYSLVNKIELPSLDDRYNSYENNW----- 161
            .:|.........::..|....|  |:||:: ..:|.:.:.:..|.:        .::.:|     
  Fly   105 GYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICI--------MWDASWKHHID 161

  Fly   162 ----VQAAGWG---AIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQ 219
                :...|||   :::|.|    :||.:|:.......|.  :|  :...|..|....:.. .|.
  Fly   162 SIKVLTGTGWGRTESMHDSS----ELRTLDISRQPSKMCA--FG--SVLSNQFCAGNWNSN-LCI 217

  Fly   220 GDSGGPLVT----KEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265
            ||:|||:..    :...:.:.:...::...||  .|:.||.|..::|:|:
  Fly   218 GDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 55/242 (23%)
Tryp_SPc 41..266 CDD:238113 55/244 (23%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 55/242 (23%)
Tryp_SPc 43..267 CDD:238113 55/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.